Skip to Main Content
Table 1.

Phosphorylation sites of juvenile MAP1B

Peptide sequence Confirmed site Ambiguous site
ATVVVEATEPEPSGSIGNPAATTSPSLSHR   S25   
DLTGQVSTPPVK   T526   
ADSRESLKPATKPLSSK   S540  
ELEAERSLMSSPEDLTKDFEELKAEEIDVAK   S823#, S824#  
DEEKLKETEPGEAYVIQKETEVSKGSAESP   S883   
QGVDDIEKFEDEGAGFEESSEAGDYEEKAETEEAEEPEEDGEDNVSGSASK   –   S928, S929*, Y934, T940  
DEALEKGEAEQSEEEGEEEE   S1008  
TQSTIEISSEPTPMDEMSTPRDVMTDETNNEETESPSQEFVNITKY   S1147*  
DYNASASTISPPSSMEEDKFSK   S1200   
SPSLSPSPPSPIEK   S1256#,*,  
SVNFSLTPNEIK   T1273   
ASAEGEATAVVSPGVTQAVVEEHCASPEEK   S1304#,  
SSISPMDEPVPDSESPIEK   –   S1367, S1368#, S1370#,* 
VLSPLRSPPLIGSESAYEDFLSADDK   S1388#,*,, S1392#,*  
QGFSDKESPVSDLTSDLYQDK   S1435  
KLGGDGSPTQVDVSQFGSFKEDTK   S1493*,  
DDVSPSLHAEVGSPHSTEV   S1571   
SEQSSMSIEFGQESPEHSLAMDFSR   S1644   
VQSLEGEKLSPK   S1770#,  
ESSPTYSPGFSDSTSGAK   S1784*  
ESTAAYQTSSSPPIDAAAAEPYGFR   –   S1801, T1802# 
DSTSGAKESTAAYQTSSSPPI   S1810   
TPGDFNYAYQKPESTTESPDEEDYDYESHEK   S1872#  
TTRTPEEGGYSYEISEK   T1940#,  
SYETTTKTTRSPDTSAY   S2025#  
CYTPERKSPSEAR   S2063  
TELSPSFINPNPLEWFAGEEPTEESERPLTQSGGAPPPSGGK   S2089#  
Peptide sequence Confirmed site Ambiguous site
ATVVVEATEPEPSGSIGNPAATTSPSLSHR   S25   
DLTGQVSTPPVK   T526   
ADSRESLKPATKPLSSK   S540  
ELEAERSLMSSPEDLTKDFEELKAEEIDVAK   S823#, S824#  
DEEKLKETEPGEAYVIQKETEVSKGSAESP   S883   
QGVDDIEKFEDEGAGFEESSEAGDYEEKAETEEAEEPEEDGEDNVSGSASK   –   S928, S929*, Y934, T940  
DEALEKGEAEQSEEEGEEEE   S1008  
TQSTIEISSEPTPMDEMSTPRDVMTDETNNEETESPSQEFVNITKY   S1147*  
DYNASASTISPPSSMEEDKFSK   S1200   
SPSLSPSPPSPIEK   S1256#,*,  
SVNFSLTPNEIK   T1273   
ASAEGEATAVVSPGVTQAVVEEHCASPEEK   S1304#,  
SSISPMDEPVPDSESPIEK   –   S1367, S1368#, S1370#,* 
VLSPLRSPPLIGSESAYEDFLSADDK   S1388#,*,, S1392#,*  
QGFSDKESPVSDLTSDLYQDK   S1435  
KLGGDGSPTQVDVSQFGSFKEDTK   S1493*,  
DDVSPSLHAEVGSPHSTEV   S1571   
SEQSSMSIEFGQESPEHSLAMDFSR   S1644   
VQSLEGEKLSPK   S1770#,  
ESSPTYSPGFSDSTSGAK   S1784*  
ESTAAYQTSSSPPIDAAAAEPYGFR   –   S1801, T1802# 
DSTSGAKESTAAYQTSSSPPI   S1810   
TPGDFNYAYQKPESTTESPDEEDYDYESHEK   S1872#  
TTRTPEEGGYSYEISEK   T1940#,  
SYETTTKTTRSPDTSAY   S2025#  
CYTPERKSPSEAR   S2063  
TELSPSFINPNPLEWFAGEEPTEESERPLTQSGGAPPPSGGK   S2089#  

Phosphorylation sites in rat MAP1B identified by tandem mass spectrometry. The table shows the peptide sequences identified by tandem mass spectrometry and, in red, the phosphorylated amino acids. In peptides in which there are ambiguous sites, only one of the listed sites is phosphorylated but which one was not able to be determined. Amino acids in green were phosphorylated in the Baliff et al. (Baliff et al., 2004) data set from embryonic mouse brain

Also present in Trinidad et al. (Trinidad et al., 2005; Trinidad et al.2006) data set from adult mouse post-synaptic densities

#

Also present in Collins et al. (Collins et al., 2005) data set from adult mouse synaptosomes

*

Also present in Ballif et al. (Baliff et al., 2004) data set

Close Modal

or Create an Account

Close Modal
Close Modal