Skip to Main Content
Table 1.

Peptide ligands and their specific receptors in higher plants

Peptide ligand Sequence Function Receptor(s)
Systemin   AVQSKPPSKRDPPKMQTD (Tomato systemin)   Defense signaling   SR160 (LRR-receptor-like kinase)  
  RGANLPOOSOASSOOSKE (TobHypSys I*)    
  NRKPLSOOSOKPADGQRP (TobHypSys II*)    
  RTOYKTOOOOTSSSOTHQ (TomHypSys I*)    
  GRHDYVASOOOOKPQXXXXX (TomHypSys II*)    
  GRHDSVLPOOSOKTD (TomHypSys III*)    
PSK   Y(SO3H)IY(SO3H)TQ   Cellular dedifferentiation and re-differentiation   PSKR (LRR-receptor-like kinase)  
CLV3  MDSKSFVLLLLLFCFLFLHDASDLTQAHAHVQGLSNRKMMMM   Growth regulation of meristem   CLV1/CLV2 (LRR-receptor-like kinase dimer)  
  KMESEWVGANGEAEKAKTKGLGLHEELRTVPSGPDPLHHHVN    
  PPRQPRNNFQLP (Deduced sequence from cDNA)    
SCR/SP11   NLMKRCTRGFRKLGKCTTLEEEKCKTLYPRGQCTCSDSKMNTH   Self incompatibility   SRK (receptor-like kinase)  
  SCDCKSC (S8-SP 11)    
Peptide ligand Sequence Function Receptor(s)
Systemin   AVQSKPPSKRDPPKMQTD (Tomato systemin)   Defense signaling   SR160 (LRR-receptor-like kinase)  
  RGANLPOOSOASSOOSKE (TobHypSys I*)    
  NRKPLSOOSOKPADGQRP (TobHypSys II*)    
  RTOYKTOOOOTSSSOTHQ (TomHypSys I*)    
  GRHDYVASOOOOKPQXXXXX (TomHypSys II*)    
  GRHDSVLPOOSOKTD (TomHypSys III*)    
PSK   Y(SO3H)IY(SO3H)TQ   Cellular dedifferentiation and re-differentiation   PSKR (LRR-receptor-like kinase)  
CLV3  MDSKSFVLLLLLFCFLFLHDASDLTQAHAHVQGLSNRKMMMM   Growth regulation of meristem   CLV1/CLV2 (LRR-receptor-like kinase dimer)  
  KMESEWVGANGEAEKAKTKGLGLHEELRTVPSGPDPLHHHVN    
  PPRQPRNNFQLP (Deduced sequence from cDNA)    
SCR/SP11   NLMKRCTRGFRKLGKCTTLEEEKCKTLYPRGQCTCSDSKMNTH   Self incompatibility   SRK (receptor-like kinase)  
  SCDCKSC (S8-SP 11)    

Predicted signal sequence is underlined.

*

These systemin peptides are glycosylated and contain hydroxyproline (one-letter abbreviation: O) residues. The amino acid sequence of TomHypSys II was estimated to be 20 amino acids in length by MALDI-MS analysis, but the amino acid analysis by Edman degradation was incomplete and only 15 residues were unambiguously assigned.

Close Modal

or Create an Account

Close Modal
Close Modal