Skip to Main Content
Table 2.

Identification of known and novel Conus striatus conotoxins by mass matching

PeptideSequenceCalculated mass (M+H)+ (Da)Observed mass (M+H)+ (Da)Reference
α-SI ICCNPACGPKYSCa 1353.5 1353.3±0.3 
α-SII GCCCNPACGPNYGCGTSCS 1790.5 1790.5 
ω-SVIA CRSSGSOCGVTSICCGRCYRGKCT 2494.0 2493.8 3, 2 
ω-SVIB CKLKGQSCRKTSYDCCSGSCGRSGKCa 2738.2 2738.0±0.1 3, 2 
s4a qKSLVPSVITTCCGYDOGTMCOOCRCTNSCa 4080.6 4080.3±0.2 
SO4 ATDCIEAGNYCGPTVMKICCGFCSPYSKICMNYPKN (with 2 hyp) 3950.6 3950.3 
SO5 STSCMEAGSYCGSTTRICCGYCAYFGKKCIDYPSN 3763.5 3763.4±0.4 
Propeller SGPADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA 9432.8** 9433.0** 
brcn GCOdWEPWCa 1068.3 1068.1 6, 7 
cn GCOdWEPWCa 990.4 990.1±0.1 6, 7 
brcnCOdWEPWCa 1011.3 1011.1 6, 7 
cnCOdWEPWCa 933.3 933.1±0.1 6, 7 
PeptideSequenceCalculated mass (M+H)+ (Da)Observed mass (M+H)+ (Da)Reference
α-SI ICCNPACGPKYSCa 1353.5 1353.3±0.3 
α-SII GCCCNPACGPNYGCGTSCS 1790.5 1790.5 
ω-SVIA CRSSGSOCGVTSICCGRCYRGKCT 2494.0 2493.8 3, 2 
ω-SVIB CKLKGQSCRKTSYDCCSGSCGRSGKCa 2738.2 2738.0±0.1 3, 2 
s4a qKSLVPSVITTCCGYDOGTMCOOCRCTNSCa 4080.6 4080.3±0.2 
SO4 ATDCIEAGNYCGPTVMKICCGFCSPYSKICMNYPKN (with 2 hyp) 3950.6 3950.3 
SO5 STSCMEAGSYCGSTTRICCGYCAYFGKKCIDYPSN 3763.5 3763.4±0.4 
Propeller SGPADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA 9432.8** 9433.0** 
brcn GCOdWEPWCa 1068.3 1068.1 6, 7 
cn GCOdWEPWCa 990.4 990.1±0.1 6, 7 
brcnCOdWEPWCa 1011.3 1011.1 6, 7 
cnCOdWEPWCa 933.3 933.1±0.1 6, 7 

The α-, ω-conotoxins and s4a have all been previously isolated from the DV and characterized.

Underlined peptides are those that are putatively identified in this work by mass matching to published cDNA sequences with predicted modifications.

Locations of PTMs are deduced by sequence homology. Sequence s4b is not included in this table since it will be the subject of a future manuscript (W. P. Kelley, J. R. Schulz, J. A. Jakubowski, W. F. Gilly and J. V. Sweedler,unpublished).

ESI-MS data is only included.

Values are means ± S.D. when multiple mass values were recorded.

**

Average mass; all other masses are monoisotopic protonated values.

brcn, bromocontryphan; cn, contryphan; * indicates[des-Gly1](bromo)contryphan form.

O, hydroxyproline (hyp); a, C-terminal amide; q, pyroglutamate; C,disulfide-bonded cysteine; S, O-linked glycosyl; W,6-bromotryptophan; d, d-amino acid, by homology to contryphan-R.

1

Zafaralla et al., 1988; 2Ramilo et al.,1992; 3Lu et al.,1999; 4Craig et al.,1998; 5Ellison,2003; 6Jimenez et al., 1996; 7Jimenez et al., 1997.

Close Modal

or Create an Account

Close Modal
Close Modal