... organ in ionoregulation, pH regulation and nitrogenous waste excretion by Daphnia magna . pH regulation Nitrogen excretion Acid–base balance Freshwater ionoregulation Calcification The gill is the predominant organ for ionoregulation in euryhaline crustaceans, and the structures...

... suggests that ammonia excretion in toadfish is modulated by cortisol-induced changes in both Rh glycoprotein expression and GS activity. * Author for correspondence ( [email protected] ) 14 10 2011 © 2012. 2012 cortisol nitrogen excretion urea ammonia plasma gill...

... both the expression of Rh isoforms and urea synthesis pathways to tightly control and regulate nitrogen excretion. Although toadfish synthesize urea de novo , a previous study reported that a nitrogen load induced by feeding may exceed the capacity of the ammonia-trapping mechanism in the liver...

..., favoring the excretion of ammonia N when food intake is accompanied by the ingestion of large volumes of water. *Author for correspondence ( [email protected] ) 30 8 2011 © 2011. 2011 ammonia Artibeus lituratus bat physiology nitrogen requirements nitrogen excretion...

... days. Series II: quantification of whole animal oxygen consumption rates over a 3 day period. Series III: detailed examination of hourly oxygen consumption rates over a 6 h period. Series IV: hourly nitrogen excretion rates in fasted R. marmoratus over a 6 h period. * Address...

...Tammy M. Rodela; Patricia A. Wright SUMMARY An unusual characteristic of nitrogen excretion in the ammoniotelic mangrove killifish Rivulus marmoratus is that urea is excreted( J urea ) in a distinct diurnal pattern, whereas ammonia is excreted ( J amm ) at a steady rate. In this study we tested...

... site of NH 3 volatilization. * Author for correspondence (e-mail: [email protected] ) 7 3 2006 © The Company of Biologists Limited 2006 2006 NH 3 volatilization nitrogen excretion ammonia excretion water pH fish skin boundary layer amphibious fish Rivulus marmoratus...

...Makiko Kajimura; Sara J. Croke; Chris N. Glover; Chris M. Wood SUMMARY Ammonia and urea are the primary forms of nitrogen excretion in teleost fish. There exists, however, a discrepancy between the sum of ammonia plus urea nitrogen and total nitrogen, indicating that `unknown' nitrogen end products...

... beginning at the first codon (ATC) is: IRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI. Bostrichthys sinensis teleost sleeper nitrogen excretion enzyme induction glutamine synthetase exogenous ammonia exposure © The Company of Biologists Limited 2002 2002...

... gills nitrogen excretion Lake Magadi tilapia © 2001 by Company of Biologists 2001 14 11 2000 15 01 2001 * Present address: RSMAS/MBF, University of Miami, 4600 Rickenbacker Causeway, Miami, FL 33149 (e-mail: [email protected] ) After linearization of mtUT...

... with the treatment period. Where might a facilitated urea transport protein be located? The cutaneous surface is thought to be the primary site of respiratory gas exchange in trout larvae ( Rombough, 1998 ), although the sites of ammonia and urea nitrogen excretion have not been determined. Nitrogen excretion...

... transporter gene UT-A2 gill nitrogen excretion The majority of adult teleost fishes excrete ammonia as their principal nitrogenous waste product. There are, however, a number of teleosts excreting a substantial proportion of waste as urea (for reviews, see Mommsen and Walsh, 1992 ; Wright, 1995...

... for the rapid range expansion towards the North recently shown by this species. * e-mail: [email protected] 2 2 2000 23 4 2000 © 2000 by Company of Biologists 2000 oxidative fuel utilization lipid carbohydrate protein nitrogen excretion energetics food...

.... Furthermore, RPAs of GSase mRNA levels demonstrated an increase of fivefold during confinement. * Author for correspondence (e-mail: [email protected] ) 27 10 1999 22 12 1999 © 2000 by Company of Biologists 2000 gulf toadfish Opsanus beta nitrogen excretion enzyme...

...Fabrice Durand; Michèle Regnault ABSTRACT Carcinus maenas and Necora puber were exposed to air for 72 h and 18 h, respectively, at 18 °C. Nitrogen excretion, blood and muscle ammonia content and blood urate and lactate content were recorded throughout the experimental emersion and following...

... 1997 18 02 1998 © The Company of Biologists Limited 1998 urea thiourea ureotelism pulsatile excretion toadfish Opsanus beta gills facilitated diffusion nitrogen excretion The gulf toadfish ( Opsanus beta ) is unusual amongst teleost fish in expressing a full...

...S. Morris; W. J. Van Aardt ABSTRACT Mechanisms of salt and water conservation, and nitrogen excretion, were investigated in the freshwater amphibious crab Potamonautes warreni from the High Veld of South Africa. Adaptations to fresh water were assessed as pre-adaptations to air-breathing...

...D. G. Varley; Peter Greenaway ABSTRACT The rate and mechanism of nitrogen excretion were examined in Geograpsus grayi . This species excretes waste nitrogen as gaseous NH 3 in periodic bursts. The mean concentration of total ammonia ([NH 3 ]+[NH 4 + ]) in the primary urine during bursts...

..., Hamilton, Ontario, Canada L8S 4K1. 13 10 1992 © 1993 by Company of Biologists 1993 ammonia transport NH 3 NH 4 + urea alkaline water pH Na + /NH 4 + exchange nitrogen excretion trout Oncorhynchus clarki henshaw Ammonia excretion in aquatic animals is strongly...

...Jon F. Harrison; John E. Phillips ABSTRACT In this study we characterized acid, ammonium and total urate excretion in the faecal pellets of unfed locusts (Schistocerca gregaria) and examined the effect of haemolymph acidosis (HCl injections into the haemocoel) on net acid and nitrogen excretion...